Recombinant Human KCNJ11

• Cat.No.: KCNJ11-29900TH
• Product Overview: Recombinant fragment corresponding to amino acids 301-390 of Human Kir6.2 with an N terminal proprietary tag; Predicted MWt 35.53 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and is found associated with the sulfonylurea receptor SUR. Mutations in this gene are a cause of familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI), an autosomal recessive disorder characterized by unregulated insulin secretion. Defects in this gene may also contribute to autosomal dominant non-insulin-dependent diabetes mellitus type II (NIDDM), transient neonatal diabetes mellitus type 3 (TNDM3), and permanent neonatal diabetes mellitus (PNDM). Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS

Gene Information

• Gene Name: KCNJ11 potassium inwardly-rectifying channel, subfamily J, member 11 [ Homo sapiens ]
• Official Symbol: KCNJ11
• Synonyms: KCNJ11; potassium inwardly-rectifying channel, subfamily J, member 11; ATP-sensitive inward rectifier potassium channel 11; BIR; Kir6.2
• Gene ID: 3767
• mRNA Refseq: NM_000525
• Protein Refseq: NP_000516
• MIM: 600937
• Uniprot ID: Q14654
• Chromosome Location: 11p15.1
• Pathway: ATP sensitive Potassium channels, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Inwardly rectifying K+ channels, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: ATP binding; ATP-activated inward rectifier potassium channel activity; inward rectifier potassium channel activity; potassium ion binding; protein C-terminus binding