Recombinant Human KCNJ10 protein, His/SUMO-tagged
Cat.No. : | KCNJ10-2596H |
Product Overview : | Recombinant Human KCNJ10(165-379aa) fused with His/SUMO tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 165-379aa |
Description : | May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by Extracellular domain barium and cesium . |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.8kDa |
AA Sequence : | FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ] |
Official Symbol | KCNJ10 |
Synonyms | KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN; |
Gene ID | 3766 |
mRNA Refseq | NM_002241 |
Protein Refseq | NP_002232 |
MIM | 602208 |
UniProt ID | P78508 |
Chromosome Location | 1q23.2 |
Pathway | Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; |
Function | ATP binding; ATP-activated inward rectifier potassium channel activity; identical protein binding; nucleotide binding; potassium channel activity; protein binding; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
KCNJ10-2357R | Recombinant Rhesus monkey KCNJ10 Protein, His-tagged | +Inquiry |
Kcnj10-294M | Recombinant Mouse Kcnj10 Full Length Transmembrane protein, His-tagged | +Inquiry |
Kcnj10-3755R | Recombinant Rat Kcnj10, His-tagged | +Inquiry |
KCNJ10-351H | Recombinant Human KCNJ10 Full Length Transmembrane protein, His-tagged | +Inquiry |
KCNJ10-29899TH | Recombinant Human KCNJ10 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ10 Products
Required fields are marked with *
My Review for All KCNJ10 Products
Required fields are marked with *
0
Inquiry Basket