Recombinant Human KCNJ1
Cat.No. : | KCNJ1-28453TH |
Product Overview : | Recombinant fragment of Human KCNJ1 with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM |
Sequence Similarities : | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ1 subfamily. |
Gene Name | KCNJ1 potassium inwardly-rectifying channel, subfamily J, member 1 [ Homo sapiens ] |
Official Symbol | KCNJ1 |
Synonyms | KCNJ1; potassium inwardly-rectifying channel, subfamily J, member 1; ATP-sensitive inward rectifier potassium channel 1; Kir1.1; ROMK1; |
Gene ID | 3758 |
mRNA Refseq | NM_000220 |
Protein Refseq | NP_000211 |
MIM | 600359 |
Uniprot ID | P48048 |
Chromosome Location | 11q24 |
Pathway | Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Inwardly rectifying K+ channels, organism-specific biosystem; |
Function | ATP binding; inward rectifier potassium channel activity; nucleotide binding; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
Kcnj1-3754M | Recombinant Mouse Kcnj1, His-tagged | +Inquiry |
KCNJ1-1431H | Recombinant Human KCNJ1 Protein (178-391 aa), His-tagged | +Inquiry |
KCNJ1-596H | Recombinant Human KCNJ1 Protein (178-391 aa), His-tagged | +Inquiry |
RFL22761HF | Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 1(Kcnj1) Protein, His-Tagged | +Inquiry |
KCNJ1-3194R | Recombinant Rat KCNJ1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ1 Products
Required fields are marked with *
My Review for All KCNJ1 Products
Required fields are marked with *
0
Inquiry Basket