Recombinant Human KCNIP4 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : KCNIP4-193H
Product Overview : KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_079497) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 28.5 kDa
AA Sequence : MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KCNIP4 Kv channel interacting protein 4 [ Homo sapiens (human) ]
Official Symbol KCNIP4
Synonyms KCNIP4; Kv channel interacting protein 4; Kv channel-interacting protein 4; CALP; KCHIP4; MGC44947; calsenilin-like protein; potassium channel interacting protein 4; potassium channel-interacting protein 4; a-type potassium channel modulatory protein 4;
Gene ID 80333
mRNA Refseq NM_025221
Protein Refseq NP_079497
MIM 608182
UniProt ID Q6PIL6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KCNIP4 Products

Required fields are marked with *

My Review for All KCNIP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon