Recombinant Human KATNAL2 protein, His-tagged

• Cat.No.: KATNAL2-1224H
• Product Overview: Recombinant Human KATNAL2 protein(1-200 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-200 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKTTAGKTGDTKSLNKEHPNQEVVDNTRLENANFGLHISRIRKDSGEENAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDAAKQLVKEAVVY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: KATNAL2
• Synonyms: KATNAL2; katanin p60 subunit A-like 2; katanin p60 ATPase-containing subunit A-like 2; DKFZP667C165; MGC33211; p60 katanin-like 2; DKFZp667C165
• Gene ID: 83473
• mRNA Refseq: NM_031303
• Protein Refseq: NP_112593
• UniProt ID: Q8IYT4