Recombinant Human JOSD1 protein, His-SUMO-tagged

• Cat.No.: JOSD1-4444H
• Product Overview: Recombinant Human JOSD1 protein(Q15040)(1-202aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-202aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.2 kDa
• AA Sequence: MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: JOSD1 Josephin domain containing 1 [ Homo sapiens ]
• Official Symbol: JOSD1
• Synonyms: JOSD1; Josephin domain containing 1; Josephin-1; KIAA0063; josephin domain-containing 1; dJ508I15.2
• Gene ID: 9929
• mRNA Refseq: NM_014876
• Protein Refseq: NP_055691
• UniProt ID: Q15040