Recombinant Human JAM3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | JAM3-6258H |
Product Overview : | JAM3 MS Standard C13 and N15-labeled recombinant protein (NP_116190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MVPARLGPAVAMVTGAGRRVLAGWAHARGDYKPRRAAAGPSATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHKSSFVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | JAM3 junctional adhesion molecule 3 [ Homo sapiens (human) ] |
Official Symbol | JAM3 |
Synonyms | JAM3; junctional adhesion molecule 3; junctional adhesion molecule C; JAM C; JAMC; JAM-2; JAM-3; JAM-C; FLJ14529; |
Gene ID | 83700 |
mRNA Refseq | NM_032801 |
Protein Refseq | NP_116190 |
MIM | 606871 |
UniProt ID | Q9BX67 |
◆ Recombinant Proteins | ||
JAM3-2794R | Recombinant Rat JAM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
JAM3-793H | Recombinant Human JAM3 Protein, Myc/DDK-tagged | +Inquiry |
JAM3-497H | Recombinant Human JAM3 Protein | +Inquiry |
JAM3-7155H | Recombinant Human Junctional Adhesion Molecule 3, His-tagged | +Inquiry |
Jam3-1871M | Recombinant Mouse Jam3 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAM3-2283MCL | Recombinant Mouse JAM3 cell lysate | +Inquiry |
JAM3-1074HCL | Recombinant Human JAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JAM3 Products
Required fields are marked with *
My Review for All JAM3 Products
Required fields are marked with *
0
Inquiry Basket