Recombinant Human JAK2 Protein, His-tagged
Cat.No. : | JAK2-01H |
Product Overview : | Recombinant human Jak2 protein (1014-1132aa), fused to His-tag at N-terminus, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1014-1132 a.a. |
Description : | This gene encodes a non-receptor tyrosine kinase that plays a central role in cytokine and growth factor signalling. The primary isoform of this protein has an N-terminal FERM domain that is required for erythropoietin receptor association, an SH2 domain that binds STAT transcription factors, a pseudokinase domain and a C-terminal tyrosine kinase domain. Cytokine binding induces autophosphorylation and activation of this kinase. This kinase then recruits and phosphorylates signal transducer and activator of transcription (STAT) proteins. Growth factors like TGF-beta 1 also induce phosphorylation and activation of this kinase and translocation of downstream STAT proteins to the nucleus where they influence gene transcription. Mutations in this gene are associated with numerous inflammatory diseases and malignancies. This gene is a downstream target of the pleiotropic cytokine IL6 that is produced by B cells, T cells, dendritic cells and macrophages to produce an immune response or inflammation. Disregulation of the IL6/JAK2/STAT3 signalling pathways produces increased cellular proliferation and myeloproliferative neoplasms of hematopoietic stem cells. A nonsynonymous mutation in the pseudokinase domain of this gene disrupts the domains inhibitory effect and results in constitutive tyrosine phosphorylation activity and hypersensitivity to cytokine signalling. This gene and the IL6/JAK2/STAT3 signalling pathway is a therapeutic target for the treatment of excessive inflammatory responses to viral infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | Liquid |
Molecular Mass : | 18.1 kDa (157aa) |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
Purity : | > 95% as analyzed by SDS-PAGE |
Applications : | SDS-PAGE, Denatured |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing, 10% glycerol, 0.4M urea |
Gene Name | JAK2 Janus kinase 2 [ Homo sapiens (human) ] |
Official Symbol | JAK2 |
Synonyms | JAK2; Janus kinase 2; JTK10; tyrosine-protein kinase JAK2; JAK-2; Janus kinase 2 (a protein tyrosine kinase); EC 2.7.10.2 |
Gene ID | 3717 |
mRNA Refseq | NM_004972 |
Protein Refseq | NP_004963 |
MIM | 147796 |
UniProt ID | O60674 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *
0
Inquiry Basket