Recombinant Human ITIH3 protein, GST-tagged
Cat.No. : | ITIH3-3624H |
Product Overview : | Recombinant Human ITIH3 protein(601-782 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 601-782 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQVW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITIH3 inter-alpha-trypsin inhibitor heavy chain 3 [ Homo sapiens ] |
Official Symbol | ITIH3 |
Synonyms | H3P |
Gene ID | 3699 |
mRNA Refseq | NM_002217.3 |
Protein Refseq | NP_002208.3 |
MIM | 146650 |
UniProt ID | Q06033 |
◆ Recombinant Proteins | ||
ITIH3-8376M | Recombinant Mouse Itih3 Protein, Myc/DDK-tagged | +Inquiry |
ITIH3-1220H | Recombinant Human ITIH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITIH3-461H | Recombinant Human ITIH3 protein(Met1-Asp651), hFc-tagged | +Inquiry |
ITIH3-774H | Recombinant Human ITIH3 protein(Met1-Asp651), His-tagged | +Inquiry |
ITIH3-3119R | Recombinant Rat ITIH3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITIH3 Products
Required fields are marked with *
My Review for All ITIH3 Products
Required fields are marked with *
0
Inquiry Basket