Recombinant Human ITGAM protein(131-350 aa), N-SUMO & C-His-tagged

• Cat.No.: ITGAM-2635H
• Product Overview: Recombinant Human ITGAM protein(P11215)(131-350 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 131-350 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM

Gene Information

• Gene Name: ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens ]
• Official Symbol: ITGAM
• Synonyms: ITGAM; integrin, alpha M (complement component 3 receptor 3 subunit); CD11B, CR3A, integrin, alpha M (complement component receptor 3, alpha; also known as CD11b (p170), macrophage antigen alpha polypeptide); integrin alpha-M; CD11b; MAC 1; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; MGC117044
• Gene ID: 3684
• mRNA Refseq: NM_000632
• Protein Refseq: NP_000623
• MIM: 120980
• UniProt ID: P11215