Recombinant Human ITGA11 Protein, GST-tagged

• Cat.No.: ITGA11-5001H
• Product Overview: Human ITGA11 partial ORF ( NP_001004439, 793 a.a. - 893 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined. [provided by RefSeq
• Molecular Mass: 36.85 kDa
• AA Sequence: LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGA11 integrin, alpha 11 [ Homo sapiens ]
• Official Symbol: ITGA11
• Synonyms: ITGA11; integrin, alpha 11; integrin alpha-11; HsT18964
• Gene ID: 22801
• mRNA Refseq: NM_001004439
• Protein Refseq: NP_001004439
• MIM: 604789
• UniProt ID: Q9UKX5