Recombinant Human ISCU protein, His&Myc-tagged

Cat.No. : ISCU-2344H
Product Overview : Recombinant Human ISCU protein(Q9H1K1)(35-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 35-167aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.3 kDa
AA Sequence : YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name ISCU iron-sulfur cluster scaffold homolog (E. coli) [ Homo sapiens ]
Official Symbol ISCU
Synonyms ISCU; iron-sulfur cluster scaffold homolog (E. coli); IscU iron sulfur cluster scaffold homolog (E. coli) , NifU like N terminal domain containing , NIFUN; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; hnifU; IscU; ISU2; nifU-like protein; NifU-like N-terminal domain containing; IscU iron-sulfur cluster scaffold homolog; nifU-like N-terminal domain-containing protein; HML; NIFU; NIFUN; 2310020H20Rik; MGC74517;
Gene ID 23479
mRNA Refseq NM_014301
Protein Refseq NP_055116
MIM 611911
UniProt ID Q9H1K1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ISCU Products

Required fields are marked with *

My Review for All ISCU Products

Required fields are marked with *

0

Inquiry Basket

cartIcon