Recombinant Human ISCU protein, His&Myc-tagged

• Cat.No.: ISCU-2344H
• Product Overview: Recombinant Human ISCU protein(Q9H1K1)(35-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&Myc
• ProteinLength: 35-167aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.3 kDa
• AA Sequence: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ISCU iron-sulfur cluster scaffold homolog (E. coli) [ Homo sapiens ]
• Official Symbol: ISCU
• Synonyms: ISCU; iron-sulfur cluster scaffold homolog (E. coli); IscU iron sulfur cluster scaffold homolog (E. coli) , NifU like N terminal domain containing , NIFUN; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; hnifU; IscU; ISU2; nifU-like protein; NifU-like N-terminal domain containing; IscU iron-sulfur cluster scaffold homolog; nifU-like N-terminal domain-containing protein; HML; NIFU; NIFUN; 2310020H20Rik; MGC74517
• Gene ID: 23479
• mRNA Refseq: NM_014301
• Protein Refseq: NP_055116
• MIM: 611911
• UniProt ID: Q9H1K1