Recombinant Human IRAK2 protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length :	14-251 aa
AA Sequence :	DDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIE
Purity :	90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	IRAK2 interleukin-1 receptor-associated kinase 2 [ Homo sapiens ]
Official Symbol	IRAK2
Synonyms	IRAK2; interleukin-1 receptor-associated kinase 2; interleukin-1 receptor-associated kinase-like 2; interleukin-1 receptor associated kinase-2; IRAK-2; MGC150550;
Gene ID	3656
mRNA Refseq	NM_001570
Protein Refseq	NP_001561
MIM	603304
UniProt ID	O43187