Recombinant Human IRAK1

• Cat.No.: IRAK1-27502TH
• Product Overview: Recombinant fragment, corresponding to amino acids 530-693 of Human IRAK with an N terminal proprietary tag; Predicted MWt 43.45 kDa.

Specification

• Description: This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein length: 164 amino acids
• Molecular Weight: 43.450kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVES DESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGE SSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQK MVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESD EFQS
• Sequence Similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain.
• Tag: Non

Gene Information

• Gene Name: IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ]
• Official Symbol: IRAK1
• Synonyms: IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle
• Gene ID: 3654
• mRNA Refseq: NM_001569
• Protein Refseq: NP_001560
• MIM: 300283
• Uniprot ID: P51617
• Chromosome Location: Xq28
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem
• Function: ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding