Recombinant Human IMP3 protein, GST-tagged
Cat.No. : | IMP3-196H |
Product Overview : | Recombinant Human IMP3(1 a.a. - 579 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
ProteinLength : | 1-579 a.a. |
Description : | This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 89.43 kDa |
AA Sequence : | MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGHAFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVP KRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLK VAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGL FPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAK VRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPR DQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IMP3 IMP3, U3 small nucleolar ribonucleoprotein [ Homo sapiens ] |
Official Symbol | IMP3 |
Synonyms | BRMS2; MRPS4; C15orf12; IMP3, U3 small nucleolar ribonucleoprotein, homolog; U3 snoRNP protein 3 homolog; U3 snoRNP protein IMP3 |
Gene ID | 55272 |
mRNA Refseq | NM_018285 |
Protein Refseq | NP_060755 |
MIM | 612980 |
UniProt ID | Q9NV31 |
Chromosome Location | 15q24 |
Pathway | Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem |
Function | poly(A) RNA binding; protein binding; NOT rRNA binding |
◆ Recombinant Proteins | ||
UBQLN1-597HF | Recombinant Full Length Human UBQLN1 Protein, GST-tagged | +Inquiry |
KCNJ10-2594H | Recombinant Human KCNJ10 protein, His-tagged | +Inquiry |
SAP029A-029-4551S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP029A_029 protein, His-tagged | +Inquiry |
MATN3-9589M | Recombinant Mouse MATN3 Protein | +Inquiry |
TMEM33-17034M | Recombinant Mouse TMEM33 Protein | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Uterus-748R | Rabbit Uterus Lysate, Total Protein | +Inquiry |
TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
COLO-383H | COLO 320HSR (human adenocarcinoma) nuclear extract lysate | +Inquiry |
HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
ZNF24-109HCL | Recombinant Human ZNF24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMP3 Products
Required fields are marked with *
My Review for All IMP3 Products
Required fields are marked with *
0
Inquiry Basket