Recombinant human immunoglobulin superfamily member 10 Protein, GST tagged

• Cat.No.: IGSF10-12H
• Product Overview: Human IGSF10 partial ORF (NP_849144, 301-399 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 301-399aa
• Description: Predicted to be involved in regulation of neuron migration. Predicted to act upstream of or within ossification. Located in extracellular region.
• Tag: N-GST
• Molecular Mass: 36.63 kDa
• AA Sequence: SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.

Gene Information

• Gene Name: IGSF10 immunoglobulin superfamily member 10 [ Homo sapiens (human) ]
• Official Symbol: IGSF10
• Synonyms: IGSF10; immunoglobulin superfamily member 10; CMF608; immunoglobulin superfamily member 10; calvaria mechanical force protein 608
• Gene ID: 285313
• mRNA Refseq: NM_178822
• Protein Refseq: NP_849144
• MIM: 617351
• UniProt ID: Q6WRI0