Recombinant Human ILDR2 Protein (1-186 aa), GST-tagged

Cat.No. : ILDR2-1045H
Product Overview : Recombinant Human ILDR2 Protein (1-186 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-186 aa
Description : May be involved in lipid homeostasis and ER stress pathways.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 48.1 kDa
AA Sequence : MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name ILDR2 immunoglobulin-like domain containing receptor 2 [ Homo sapiens ]
Official Symbol ILDR2
Synonyms C1orf32; dJ782G3.1; RP4-782G3.2;
Gene ID 387597
mRNA Refseq NM_199351.2
Protein Refseq NP_955383.1
UniProt ID Q71H61

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ILDR2 Products

Required fields are marked with *

My Review for All ILDR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon