Recombinant Human ILDR2 Protein (1-186 aa), GST-tagged

• Cat.No.: ILDR2-1045H
• Product Overview: Recombinant Human ILDR2 Protein (1-186 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-186 aa
• Description: May be involved in lipid homeostasis and ER stress pathways.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 48.1 kDa
• AA Sequence: MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ILDR2 immunoglobulin-like domain containing receptor 2 [ Homo sapiens ]
• Official Symbol: ILDR2
• Synonyms: C1orf32; dJ782G3.1; RP4-782G3.2
• Gene ID: 387597
• mRNA Refseq: NM_199351.2
• Protein Refseq: NP_955383.1
• UniProt ID: Q71H61