Recombinant Human IL8, StrepII-tagged
Cat.No. : | IL8-273H |
Product Overview : | Purified, full-length human recombinant IL8 protein (amino acids 21-99, 79 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.1 kDa. (Accession NP_000575; UniProt P10145) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 21-99, 79 a.a. |
Description : | IL8 is a member of the CXC chemokine family. It is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. In addition to acting as a chemoattractant, it is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKR AENS |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | IL8 interleukin 8 [ Homo sapiens ] |
Official Symbol | IL8 |
Synonyms | IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1; |
Gene ID | 3576 |
mRNA Refseq | NM_000584 |
Protein Refseq | NP_000575 |
MIM | 146930 |
UniProt ID | P10145 |
Chromosome Location | 4q13-q21 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; |
Function | chemokine activity; interleukin-8 receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IL8-154H | Recombinant Human IL8, None tagged | +Inquiry |
IL8-2471H | Recombinant Human IL8 Protein (Ala23-Ser99), His tagged | +Inquiry |
IL8-153H | Recombinant Human IL8, None tagged | +Inquiry |
IL8-48O | Recombinant Ovine IL-8 (CXCL8) | +Inquiry |
IL8-362H | Active Recombinant Human IL8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
0
Inquiry Basket