Recombinant Human IL8, StrepII-tagged

• Cat.No.: IL8-273H
• Product Overview: Purified, full-length human recombinant IL8 protein (amino acids 21-99, 79 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.1 kDa. (Accession NP_000575; UniProt P10145)

Specification

• Species: Human
• Source: Human Cells
• Tag: StrepII
• ProteinLength: 21-99, 79 a.a.
• Description: IL8 is a member of the CXC chemokine family. It is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. In addition to acting as a chemoattractant, it is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKR AENS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: IL8 interleukin 8 [ Homo sapiens ]
• Official Symbol: IL8
• Synonyms: IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1
• Gene ID: 3576
• mRNA Refseq: NM_000584
• Protein Refseq: NP_000575
• MIM: 146930
• UniProt ID: P10145
• Chromosome Location: 4q13-q21
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem
• Function: chemokine activity; interleukin-8 receptor binding; protein binding