Recombinant Human IL8 Protein

• Cat.No.: IL8-189H
• Product Overview: Recombinant Human IL8 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Interleukin 8 (IL-8 or CXCL8) is a member of the CXC cytokine family and is produced by macrophages, epithelial, smooth muscle, and endothelial cells. IL-8 binds the G protein-coupled serpentine receptors CXCR1 and CXCR2. IL-8 recruits innate immune cells, induces phagocytosis, and stimulates angiogenesis.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 8.9 kDa (77 aa)
• AA Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IL8 interleukin 8 [ Homo sapiens (human) ]
• Official Symbol: IL8
• Synonyms: IL8; interleukin 8; interleukin-8; 3 10C; alveolar macrophage chemotactic factor I; AMCF I; b ENAP; beta endothelial cell derived neutrophil activating peptide; chemokine (C X C motif) ligand 8; CXCL8; GCP 1; GCP1; granulocyte chemotactic protein 1; IL 8; K60; LECT; LUCT; lung giant cell carcinoma derived chemotactic protein; lymphocyte derived neutrophil activating peptide; LYNAP; MDNCF; MONAP; monocyte derived neutrophil chemotactic factor; monocyte derived neutrophil activating peptide; NAF; NAP 1; NAP1; neutrophil activating peptide 1; SCYB8; TSG 1; tumor necrosis factor induced gene 1; emoctakin; T-cell chemotactic factor; neutrophil-activating peptide 1; chemokine (C-X-C motif) ligand 8; beta-thromboglobulin-like protein; tumor necrosis factor-induced gene 1; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide; GCP-1; NAP-1
• Gene ID: 3576
• mRNA Refseq: NM_000584
• Protein Refseq: NP_000575
• MIM: 146930
• UniProt ID: P10145