Recombinant Human IL6ST
Cat.No. : | IL6ST-26366TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 23-122 of Human CD130 , with an N-terminal proprietary tag, 36.63 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A related pseudogene has been identified on chromosome 17. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
Gene Name | IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ] |
Official Symbol | IL6ST |
Synonyms | IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130; |
Gene ID | 3572 |
mRNA Refseq | NM_001190981 |
Protein Refseq | NP_001177910 |
MIM | 600694 |
Uniprot ID | P40189 |
Chromosome Location | 5q11.2 |
Pathway | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; growth factor binding; contributes_to growth factor binding; interleukin-27 receptor activity; |
◆ Recombinant Proteins | ||
Il6st-173M | Recombinant Mouse Il6st protein, His-tagged | +Inquiry |
IL6ST-182H | Recombinant Human IL6ST Protein, ENLYFQ-tagged, Biotinylated | +Inquiry |
Il6st-4091R | Recombinant Rat Il6st, Fc-His tagged | +Inquiry |
IL6ST-787H | Recombinant Human IL6ST protein, His-tagged | +Inquiry |
Il6st-4011M | Recombinant Mouse Il6st protein(Met1-Glu617), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6ST-1882RCL | Recombinant Rat IL6ST cell lysate | +Inquiry |
IL6ST-935HCL | Recombinant Human IL6ST cell lysate | +Inquiry |
IL6ST-946CCL | Recombinant Cynomolgus IL6ST cell lysate | +Inquiry |
IL6ST-001MCL | Recombinant Mouse IL6ST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6ST Products
Required fields are marked with *
My Review for All IL6ST Products
Required fields are marked with *
0
Inquiry Basket