Recombinant Human IL6ST

• Cat.No.: IL6ST-26366TH
• Product Overview: Recombinant fragment, corresponding to amino acids 23-122 of Human CD130 , with an N-terminal proprietary tag, 36.63 kDa inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A related pseudogene has been identified on chromosome 17.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
• Sequence Similarities: Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Gene Information

• Gene Name: IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ]
• Official Symbol: IL6ST
• Synonyms: IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130
• Gene ID: 3572
• mRNA Refseq: NM_001190981
• Protein Refseq: NP_001177910
• MIM: 600694
• Uniprot ID: P40189
• Chromosome Location: 5q11.2
• Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; growth factor binding; contributes_to growth factor binding; interleukin-27 receptor activity