Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 555 conjugated

• Cat.No.: IL3RA-29795THAF555
• Product Overview: Alexa Fluor 555 conjugated recombinant fragment, corresponding to amino acids 19-302 of Human IL3RA fused to the Fc region of human IgG1 expressed in modified human 293 cells, 533 amino acids, Predicted MWt 60.6 kDa.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 19-302 a.a.
• Description: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y.
• Form: Lyophilized
• N-terminal Sequence Analysis: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADY SMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILF PENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADV QYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISR LSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTP QRFECDQEEGANTRGGRVDGIQWIPKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Purity: > 95 % as determined by SDS-PAGE
• Characteristic: Disulfide-linked homodimer
  Labeled with Alexa Fluor 555 via amines
  With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters.
• Storage: Store at +4 centigrade.
• Storage Buffer: 10% Trehalose, 1% Human serum albumin
• Reconstitution: It is recommended that 0.5 mL of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4 centigrade is recommended, with longer-term storage in aliquots at -18 to -20 centigrade. Repeated freeze thawing is not recommended.

Gene Information

• Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
• Official Symbol: IL3RA
• Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123
• Gene ID: 3563
• mRNA Refseq: NM_002183
• Protein Refseq: NP_002174
• MIM: 308385
• UniProt ID: P26951