Recombinant Human IL3RA, His-Flag-StrepII-tagged

Cat.No. : IL3RA-430H
Product Overview : Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag&His&Strep II
Protein Length : 19-305 a.a.
Form : 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Molecular Mass : 34.65 kDa
AA Sequence : TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Concentration : ≥ 10 ug/ml
Gene Name IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Official Symbol IL3RA
Synonyms IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra
Gene ID 3563
mRNA Refseq NM_002183
Protein Refseq NP_002174
MIM 308385
UniProt ID P26951

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL3RA Products

Required fields are marked with *

My Review for All IL3RA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon