Recombinant Human IL3RA, His-Flag-StrepII-tagged
Cat.No. : | IL3RA-430H |
Product Overview : | Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag&His&Strep II |
Protein Length : | 19-305 a.a. |
Form : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 ug/ml |
Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
Official Symbol | IL3RA |
Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra |
Gene ID | 3563 |
mRNA Refseq | NM_002183 |
Protein Refseq | NP_002174 |
MIM | 308385 |
UniProt ID | P26951 |
◆ Recombinant Proteins | ||
IL3RA-03M | Recombinant Mouse IL3RA Protein, hIgG-His-tagged | +Inquiry |
Il3ra-918MF | Recombinant Mouse Il3ra Protein, Fc-tagged, FITC conjugated | +Inquiry |
IL3RA-327H | Active Recombinant Human IL3RA protein, lFc-tagged | +Inquiry |
IL3RA-29795THAF488 | Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
IL3RA-420H | Recombinant Human IL3RA, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *
0
Inquiry Basket