Recombinant Human IL36RN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IL36RN-2553H
• Product Overview: IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.
• Molecular Mass: 16.8 kDa
• AA Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IL36RN interleukin 36 receptor antagonist [ Homo sapiens (human) ]
• Official Symbol: IL36RN
• Synonyms: IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP
• Gene ID: 26525
• mRNA Refseq: NM_012275
• Protein Refseq: NP_036407
• MIM: 605507
• UniProt ID: Q9UBH0