Recombinant Human IL36A protein

• Cat.No.: IL36A-506H
• Product Overview: Recombinant Human IL36A protein (Interleukin-36 alpha, 158a.a.) was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 158
• Description: Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. Studies showed IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant human interleukin-36 alpha contains 158 amino acids residues which is a single non-glycosylated polypeptide and it is 30 % a.a. identical to IL-1ra, and 27 %, 31 %, 36 %, 46 %, 57% and 28 % a.a. identical to IL-1β, IL-36Ra/IL-1F5, IL-37/IL-1F7, IL-36β/IL-1F8, IL-36γ/IL-1F9 and IL-1F10.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.
• Molecular Mass: Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids.
• AA Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
• Endotoxin: Less than 1 EU/μg of rHuIL-36α, 158a.a. as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL36A
• Official Symbol: IL36A
• Synonyms: IL36A; interleukin 36, alpha; IL1F6, interleukin 1 family, member 6 (epsilon); interleukin-36 alpha; FIL1; FIL1E; IL 1F6; IL1(EPSILON); MGC129552; MGC129553; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; IL-1F6 (FIL-1-epsilon); interleukin 1, epsilon; interleukin-1 family member 6; interleukin 1 family, member 6 (epsilon); IL1F6; IL-1F6; FIL1(EPSILON)
• Gene ID: 27179
• mRNA Refseq: NM_014440
• Protein Refseq: NP_055255
• MIM: 605509
• UniProt ID: Q9UHA7