Recombinant Human IL2RG Protein, C-His-tagged

• Cat.No.: IL2RG-067H
• Product Overview: Recombinant Human IL2RG Protein with C-His tag was expressed in E. coli.

Specification

• Description: The IL-2 receptor is a multicomponent complex consisting of three subunits, a, b and g, each of which is required for high affinity binding of IL-2. The a chain functions primarily in binding IL-2, whereas the b and g chains contribute to IL-2 binding and are essential to IL-2-induced activation of signaling pathways leading to T cell growth. Both IL-4R and IL-7R were initially described as single chain high affinity ligand binding cytokine receptors. However, it is now well established that the IL-2R g chain functions as a second subunit of the high affinity IL-4R and IL-7R receptors. Consequently, the originally described subunits of these latter receptors are now referred to as IL-4Ra and IL-7Ra respectively, while the common subunit is referred to as gc. Although the common g chain enhances ligand binding in these three cytokine receptors, it has no capacity to bind these ligands on its own.There is evidence that the gc chain is also a subunit of IL-13R.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~26 kDa
• AA Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: IL2RG interleukin 2 receptor, gamma [ Homo sapiens (human) ]
• Official Symbol: IL2RG
• Synonyms: IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1
• Gene ID: 3561
• mRNA Refseq: NM_000206
• Protein Refseq: NP_000197
• MIM: 308380
• UniProt ID: P31785