Recombinant Human IL23A
Cat.No. : | IL23A-29782TH |
Product Overview : | Recombinant Human IL23 is a heterodimeric protein consisting of two subunits, p19 and p40 ; MWt 53.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hi-5 Insect Cells |
Tag : | Non |
Description : | This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. |
Molecular Weight : | 53.500kDa |
Tissue specificity : | Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). |
Biological activity : | Biological activity measured by the ability to induce IL-17 secretion by mouse splenocytes. |
Form : | Lyophilised:Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer co |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 1X PBS, pH 7.2 |
Storage : | The lyophilized protein is stable at room temperature for up to 1 month. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C. Avoid repeated freeze/thaw cycles. See reconstitution notes |
Sequences of amino acids : | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Sequence Similarities : | Belongs to the IL-6 superfamily. |
Gene Name | IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ] |
Official Symbol | IL23A |
Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; |
Gene ID | 51561 |
mRNA Refseq | NM_016584 |
Protein Refseq | NP_057668 |
MIM | 605580 |
Uniprot ID | Q9NPF7 |
Chromosome Location | 12q13.13 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL23-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; |
Function | cytokine activity; contributes_to interleukin-23 receptor binding; |
◆ Recombinant Proteins | ||
Il23a-2461M | Recombinant Mouse Il23a protein, His-tagged | +Inquiry |
IL23A-4846H | Recombinant Human IL23A Protein (Arg20-Pro189), C-His tagged | +Inquiry |
IL23a-3326R | Recombinant Rat IL23a protein, His-tagged | +Inquiry |
IL23A-01H | Active Recombinant Human IL23A Protein, Myc/DDK-tagged | +Inquiry |
IL23A-451H | Recombinant Human IL23A Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?
02/01/2023
Please inquiry our product manager with specific product.
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *
0
Inquiry Basket