Recombinant Human IL21R protein, T7/His-tagged

• Cat.No.: IL21R-99H
• Product Overview: Recombinant human CD360 cDNA (20 – 232 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSC SLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWS EWSDPVIFQTQSEELKE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD360 protein mediated T cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD360 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Protein length: 20-232 a.a.

Gene Information

• Gene Name: IL21R interleukin 21 receptor [ Homo sapiens ]
• Official Symbol: IL21R
• Synonyms: IL21R; interleukin 21 receptor; interleukin-21 receptor; CD360; IL-21R; IL-21 receptor; novel interleukin receptor; NILR; MGC10967
• Gene ID: 50615
• mRNA Refseq: NM_021798
• Protein Refseq: NP_068570
• MIM: 605383
• UniProt ID: Q9HBE5
• Chromosome Location: 16p11
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: interleukin-21 receptor activity; receptor activity