Recombinant Human IL20, StrepII-tagged
Cat.No. : | IL20-268H |
Product Overview : | Purified, full-length human recombinant IL20 protein (amino acids 34-179, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17.5 kDa. (Accession NP_061194.2; UniProt Q9NYY1) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 34-179, 146 a.a. |
Description : | IL20 is a cytokine structurally related to IL10. This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLI GEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKD TVKKLGESGEIKAIGELDLLFMSLRNACI |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80~80%% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IL20 interleukin 20 [ Homo sapiens ] |
Official Symbol | IL20 |
Synonyms | IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907; |
Gene ID | 50604 |
mRNA Refseq | NM_018724 |
Protein Refseq | NP_061194 |
MIM | 605619 |
UniProt ID | Q9NYY1 |
Chromosome Location | 1q32 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; interleukin-20 receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
IL20-965H | Recombinant Human IL20 Protein | +Inquiry |
IL20-160H | Recombinant Human IL20 Protein | +Inquiry |
IL20-3566H | Recombinant Human IL20 Protein (Leu25-Glu176), C-His tagged | +Inquiry |
Il20-01M | Active Recombinant Mouse Il20 Protein, His-Tagged | +Inquiry |
Il20-47R | Recombinant Rat Il20, None tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20-5233HCL | Recombinant Human IL20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL20 Products
Required fields are marked with *
My Review for All IL20 Products
Required fields are marked with *
0
Inquiry Basket