Recombinant Human IL20, StrepII-tagged

• Cat.No.: IL20-268H
• Product Overview: Purified, full-length human recombinant IL20 protein (amino acids 34-179, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17.5 kDa. (Accession NP_061194.2; UniProt Q9NYY1)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 34-179, 146 a.a.
• Description: IL20 is a cytokine structurally related to IL10. This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLI GEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKD TVKKLGESGEIKAIGELDLLFMSLRNACI
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80~80%% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL20 interleukin 20 [ Homo sapiens ]
• Official Symbol: IL20
• Synonyms: IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907
• Gene ID: 50604
• mRNA Refseq: NM_018724
• Protein Refseq: NP_061194
• MIM: 605619
• UniProt ID: Q9NYY1
• Chromosome Location: 1q32
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; interleukin-20 receptor binding; receptor binding