Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein(Denileukin diftitox)

• Cat.No.: diphtheria toxin&IL2-P031H
• Product Overview: A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system.

Specification

• Description: The expression product is the active ingredient of Ontak.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: 57.6 kDa
• Protein length: diphtheria toxin fragments A and B (Met 1-Thr 387); IL-2(la 1-Thr 133)
• AA Sequence: MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNE NPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFA EGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDK TKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAV NVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIG FAAYNFVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNP KLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMC EYADETATIVEFLNRWITFCQSIISTLT
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Alias: IL2; IL 2; TCGF; IL-2; Denileukin diftitox

Gene Information

• Gene Name: IL2 interleukin 2 [ Homo sapiens ]
• Official Symbol: IL2
• Synonyms: IL2; interleukin 2; interleukin-2; IL 2; T cell growth factor; TCGF; aldesleukin; involved in regulation of T-cell clonal expansion; IL-2; lymphokine
• Gene ID: 3558
• mRNA Refseq: NM_000586
• Protein Refseq: NP_000577
• MIM: 147680
• UniProt ID: P60568
• Chromosome Location: 4q26-q27
• Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem
• Function: carbohydrate binding; cytokine activity; glycosphingolipid binding; growth factor activity; interleukin-2 receptor binding; interleukin-2 receptor binding; kappa-type opioid receptor binding; kinase activator activity