Recombinant Human IL1RN therapeutic protein(Anakinra)

Cat.No. : IL1RN-P038H
Product Overview : The therapeutic protein is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between the protein and the native human IL-1Ra is that the protein has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. The expression product is the active ingredient of Kineret.
Source : E. coli
Species : Human
Molecular Mass : 17.3 kDa
Protein length : 153 aa
AA Sequence : MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCV KSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGV MVTKFYFQEDE
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Tag : Non
Alias : IL1RN; DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; Anakinra
Gene Name IL1RN interleukin 1 receptor antagonist [ Homo sapiens ]
Official Symbol IL1RN
Synonyms IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA;
Gene ID 3557
mRNA Refseq NM_000577
Protein Refseq NP_000568
MIM 147679
UniProt ID P18510
Chromosome Location 2q14.2
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; IL-1 Signaling Pathway, organism-specific biosystem; IL1-mediated signaling events, organism-specific biosystem; Immune System, organism-specific biosystem; Interleukin-1 signaling, organism-specific biosystem; Signaling by Interleukins, organism-specific biosystem;
Function interleukin-1 Type I receptor antagonist activity; interleukin-1 Type II receptor antagonist activity; interleukin-1 receptor antagonist activity; interleukin-1 receptor antagonist activity; interleukin-1 receptor binding; interleukin-1, Type I receptor binding; interleukin-1, Type II receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon