Recombinant Human IL1RN protein
Cat.No. : | IL1RN-05H |
Product Overview : | Recombinant Human IL1RN protein was expressed in Escherichia coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 152 |
Description : | Interleukin-1 receptor antagonist (IL-1RA) is a member of the IL-1 family. IL1RA is secreted by various types of cells including immune cells, epithelial cells, and adipocytes, and is a natural inhibitor of the pro-inflammatory effect of IL1β. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL1-RA. The regulated expression of IL1RA in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts the synthesis of IL-1RA is markedly enhanced by IL-1, TNF-alpha, or PDGF. The protein shows 26 % amino acid homology to IL1β and 19 % homology to IL1α. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 50 pg/ml rHuIL-1α. |
Molecular Mass : | Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
AA Sequence : | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Endotoxin : | Less than 1 EU/µg of rHuIL-1RA as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Publications : |
Proinflammatory cytokines induce endocrine differentiation in pancreatic ductal cells via STAT3-dependent NGN3 activation (2016)
|
Gene Name | IL1RN |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA; |
Gene ID | 3557 |
mRNA Refseq | NM_000577 |
Protein Refseq | NP_000568 |
MIM | 147679 |
UniProt ID | P18510 |
◆ Recombinant Proteins | ||
Il1rn-6741M | Recombinant Mouse Il1rn Protein (Arg27-Gln178) | +Inquiry |
IL1RN-4269H | Recombinant Human IL1RN Protein (Arg26-Glu177), N-Fc tagged | +Inquiry |
Il1rn-546M | Recombinant Mouse Il1rn protein | +Inquiry |
IL1RN-0278C | Recombinant Cynomolgus IL1RN protein, His-tagged | +Inquiry |
Il1rn-231M | Recombinant Mouse Interleukin-1 Receptor Antagonist | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket