Recombinant Human IL1RN protein

Cat.No. : IL1RN-05H
Product Overview : Recombinant Human IL1RN protein was expressed in Escherichia coli.
Availability April 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 152
Description : Interleukin-1 receptor antagonist (IL-1RA) is a member of the IL-1 family. IL1RA is secreted by various types of cells including immune cells, epithelial cells, and adipocytes, and is a natural inhibitor of the pro-inflammatory effect of IL1β. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL1-RA. The regulated expression of IL1RA in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts the synthesis of IL-1RA is markedly enhanced by IL-1, TNF-alpha, or PDGF. The protein shows 26 % amino acid homology to IL1β and 19 % homology to IL1α.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 50 pg/ml rHuIL-1α.
Molecular Mass : Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids.
AA Sequence : RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Endotoxin : Less than 1 EU/µg of rHuIL-1RA as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Publications :
Proinflammatory cytokines induce endocrine differentiation in pancreatic ductal cells via STAT3-dependent NGN3 activation (2016)
Gene Name IL1RN
Official Symbol IL1RN
Synonyms IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA;
Gene ID 3557
mRNA Refseq NM_000577
Protein Refseq NP_000568
MIM 147679
UniProt ID P18510

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon