Recombinant Human IL1B protein, His-SUMO-tagged
Cat.No. : | IL1B-3096H |
Product Overview : | Recombinant Human IL1B protein(P01584)(117-269aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 117-269aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL1B interleukin 1, beta [ Homo sapiens ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
Gene ID | 3553 |
mRNA Refseq | NM_000576 |
Protein Refseq | NP_000567 |
MIM | 147720 |
UniProt ID | P01584 |
◆ Recombinant Proteins | ||
IL1B-6744H | Recombinant Human IL1B protein, His-Avi-tagged, Biotinylated | +Inquiry |
Il1b-2831M | Recombinant Mouse Il1b protein, His & T7-tagged | +Inquiry |
IL1B-6353H | Recombinant Human IL1B protein, His-Avi-tagged | +Inquiry |
Il1B-39H | Recombinant Human Il1B protein, low endotoxin | +Inquiry |
Il1b-2829G | Recombinant Guinea pig Il1b protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket