Recombinant Human IL1A protein, GST-tagged
Cat.No. : | IL1A-14167H |
Product Overview : | Recombinant Human IL1A protein (113-271 aa) fused to GST-tag and was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 159 |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 44 kDa |
AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Samples are stable for up to twelve months from date of receipt at -20 centigrade to -80 centigrade Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | IL1A |
Official Symbol | IL1A |
Synonyms | IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha |
Gene ID | 3552 |
mRNA Refseq | NM_000575.5 |
Protein Refseq | NP_000566.3 |
MIM | 147760 |
UniProt ID | P01583 |
◆ Recombinant Proteins | ||
IL1a-01M | Active Recombinant Mouse IL1a Protein, His-Tagged | +Inquiry |
Il1a-6734M | Recombinant Mouse Il1a Protein (Ser115-Ser270) | +Inquiry |
IL1A-623H | Recombinant Horse IL1A protein, His-tagged | +Inquiry |
Il1a-627M | Recombinant Mouse Il1a protein, His & T7-tagged | +Inquiry |
IL1A-631R | Recombinant Rabbit IL1A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *
0
Inquiry Basket