Recombinant Human IL19 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IL19-1470H
• Product Overview: IL19 MS Standard C13 and N15-labeled recombinant protein (NP_037503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
• Molecular Mass: 20.45 kDa
• AA Sequence: MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IL19 interleukin 19 [ Homo sapiens (human) ]
• Official Symbol: IL19
• Synonyms: IL19; interleukin 19; interleukin-19; IL 10C; IL 19; MDA1; melanoma differentiation associated protein like protein; NG.1; ZMDA1; melanoma differentiation associated protein-like protein; melanoma differentiation-associated protein-like protein; IL-10C
• Gene ID: 29949
• mRNA Refseq: NM_013371
• Protein Refseq: NP_037503
• MIM: 605687
• UniProt ID: Q9UHD0