Recombinant Human IL17F protein
Cat.No. : | IL17F-36H |
Product Overview : | Recombinant Human IL17F protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 134 |
Description : | Human Interleukin-17F (IL-17F) is encoded by the IL17F gene located on the chromosome 6 and belongs to the IL-17 family which contains IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17F that shares 50 % homologous of crystal structure to IL-17A and is expressed by activated T cells, has the functions of stimulating production of other cytokines (such as IL-6, IL-8 and granulocyte colony-stimulating factor) and proliferation of PBMC and T-cell, regulating cartilage matrix turnover, and inhibiting angiogenesis. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 30.1 kDa, a disulfide-linked homodimer of two 134 amino acid polypeptide chains. |
AA Sequence : | MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
Endotoxin : | Less than 1 EU/µg of rHuIL-17F as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 6 mM HCl to a concentration of 0.1mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL17F |
Official Symbol | IL17F |
Synonyms | IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F; |
Gene ID | 112744 |
mRNA Refseq | NM_052872 |
Protein Refseq | NP_443104 |
MIM | 606496 |
UniProt ID | Q96PD4 |
◆ Recombinant Proteins | ||
IL17F-57B | Recombinant Bovine IL-17F | +Inquiry |
IL17F-367H | Active Recombinant Human Interleukin 17F, HIgG1 Fc-tagged | +Inquiry |
IL17F-365H | Active Recombinant Human Interleukin 17F, HIgG1 Fc-tagged | +Inquiry |
IL17F-4333R | Recombinant Rabbit IL17F Protein | +Inquiry |
IL17F-3654H | Recombinant Human IL17F Protein (Arg31-Gln163), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *
0
Inquiry Basket