Recombinant Human IL17B protein

• Cat.No.: IL17B-29741TH
• Product Overview: Recombinant Human IL17B protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 161
• Description: The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. Alternative splicing results in multiple splice variants.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.1 % Tween-20 and 3 % Trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion of human HepG2 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
• Molecular Mass: Approximately 36.5 kDa, a non-disulfide-linked homodimer of two 161 amino acid polypeptide chains.
• AA Sequence: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
• Endotoxin: Less than 0.1 EU/µg of rHuIL-17B as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL17B
• Official Symbol: IL17B
• Synonyms: IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B
• Gene ID: 27190
• mRNA Refseq: NM_014443
• Protein Refseq: NP_055258
• MIM: 604627
• UniProt ID: Q9UHF5