Recombinant Human IL15RA protein, His&Myc-tagged

• Cat.No.: IL15RA-4379H
• Product Overview: Recombinant Human IL15RA protein(Q13261)(31-205aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 31-205aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.4 kDa
• AA Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IL15RA interleukin 15 receptor, alpha [ Homo sapiens ]
• Official Symbol: IL15RA
• Synonyms: IL15RA; interleukin 15 receptor, alpha; interleukin-15 receptor subunit alpha; CD215; IL 15RA; MGC104179
• Gene ID: 3601
• mRNA Refseq: NM_001243539
• Protein Refseq: NP_001230468
• MIM: 601070
• UniProt ID: Q13261