Recombinant Human IL13 protein, hFc-Myc-tagged

• Cat.No.: IL13-4324H
• Product Overview: Recombinant Human IL13 protein(P35225)(21-132aa), fused to C-terminal hFc tag and Myc tag, was expressed in Mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc&Myc
• Protein Length: 21-132aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42 kDa
• AA Sequence: TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IL13 interleukin 13 [ Homo sapiens ]
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13
• Gene ID: 3596
• mRNA Refseq: NM_002188
• Protein Refseq: NP_002179
• MIM: 147683
• UniProt ID: P35225