Recombinant Human IL13 protein

• Cat.No.: IL13-165H
• Product Overview: Recombinant Human IL13 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 112
• Description: Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5. IL-13 is a 132 amino acid protein containing a proposed 20 amino acid signal peptide, and shares approximately 30% amino acid sequence homology to human IL-4. Additionally, the two cytokines exhibit overlapping biological activities. Human IL-13 is produced by activated Th0, Th1-like Th2-like and CD8 T cells. Similarly to IL-4, IL-13 has multiple effects on the differentiation and functions of monocytes/macrophages. IL-13 can suppress the cytotoxic functions of monocytes/macrophages.IL-13 variant is a natural variant of IL-13 and has a Q instead of R112 of wild type, which associated with increased risk for asthma development and at homozygosity associated with higher levels of serum total IgE in some allergic rhinitis patients.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.2, with 5 % trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids, with a substitution of Q for R at position 112 compared with the wild type IL-13.
• AA Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
• Endotoxin: Less than 1 EU/µg of rHuIL-13, Variant as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL13
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13
• Gene ID: 3596
• mRNA Refseq: NM_002188
• Protein Refseq: NP_002179
• MIM: 147683
• UniProt ID: P35225