Recombinant Human IL12B protein, His-tagged

• Cat.No.: IL12B-3433H
• Product Overview: Recombinant Human IL12B protein(P29460)(23-328aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Human
• Tag: C-His
• Protein length: 23-328aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.8 kDa
• AASequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ]
• Official Symbol: IL12B
• Synonyms: IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B
• Gene ID: 3593
• mRNA Refseq: NM_002187
• Protein Refseq: NP_002178
• MIM: 161561
• UniProt ID: P29460