Recombinant Human IL12B Protein, Fc-tagged
Cat.No. : | IL12B-503H |
Product Overview : | Recombinant human IL12B protein with a Fc tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 328 |
Description : | This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. |
Form : | Lyophilized |
AA Sequence : | MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens (human) ] |
Official Symbol | IL12B |
Synonyms | IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B; |
Gene ID | 3593 |
mRNA Refseq | NM_002187 |
Protein Refseq | NP_002178 |
MIM | 161561 |
UniProt ID | P29460 |
◆ Recombinant Proteins | ||
IL12B-4303H | Recombinant Human IL12B Protein (Met1-Ser328), C-His tagged | +Inquiry |
IL12B-181I | Active Recombinant Human IL12B Protein | +Inquiry |
IL12B-846H | Recombinant Horse IL12B protein, His & T7-tagged | +Inquiry |
IL12B-1164H | Recombinant Human IL12B Protein, His (Fc)-Avi-tagged | +Inquiry |
Il12b-348M | Recombinant Mouse Il12b, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12B Products
Required fields are marked with *
My Review for All IL12B Products
Required fields are marked with *
0
Inquiry Basket