Recombinant Human IL12A Protein, Fc-tagged
Cat.No. : | IL12A-501H |
Product Overview : | Recombinant human IL12A protein with a Fc tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 219 |
Description : | This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. |
Form : | Lyophilized |
AA Sequence : | MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens (human) ] |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
IL12-21H | Recombinant Human Interleukin-12 | +Inquiry |
IL12A-1637Z | Recombinant Zebrafish IL12A | +Inquiry |
IL12A-4300H | Recombinant Human IL12A Protein (Met1-Ser219), C-His tagged | +Inquiry |
Il12a-228M | Recombinant Mouse Interleukin 12a, P80 | +Inquiry |
IL12A-850H | Recombinant Human IL12A protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *
0
Inquiry Basket