Recombinant Human IL10, StrepII-tagged
Cat.No. : | IL10-267H |
Product Overview : | Purified, full-length human recombinant IL10 protein (amino acids 19-178, 160 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.6 kDa. (Accession NP_000563; UniProt P22301) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 19-178, 160 a.a. |
Description : | IL10 is a cytokine produced primarily by monocytes and, to a lesser extent, by lymphocytes. IL10 has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. It belongs to the IL10 family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ EKGIYKAMSEFDIFINYIEAYMTMKIRN |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IL10 interleukin 10 [ Homo sapiens ] |
Official Symbol | IL10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451; |
Gene ID | 3586 |
mRNA Refseq | NM_000572 |
Protein Refseq | NP_000563 |
MIM | 124092 |
UniProt ID | P22301 |
Chromosome Location | 1q31-q32 |
Pathway | African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Asthma, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; interleukin-10 receptor binding; |
◆ Recombinant Proteins | ||
IL10-174H | Active Recombinant Human IL10 Protein (Ser19-Asn178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL10-246C | Active Recombinant Chicken Interleukin 10 | +Inquiry |
IL10-28928TH | Recombinant Human IL10, His-tagged | +Inquiry |
IL10-0021H | Recombinant Human IL10 Protein | +Inquiry |
Il10-45M | Active Recombinant Mouse Il10 Protein (Ser19-Ser178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket