Recombinant Human IL10, StrepII-tagged

• Cat.No.: IL10-267H
• Product Overview: Purified, full-length human recombinant IL10 protein (amino acids 19-178, 160 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.6 kDa. (Accession NP_000563; UniProt P22301)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 19-178, 160 a.a.
• Description: IL10 is a cytokine produced primarily by monocytes and, to a lesser extent, by lymphocytes. IL10 has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. It belongs to the IL10 family.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ EKGIYKAMSEFDIFINYIEAYMTMKIRN
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL10 interleukin 10 [ Homo sapiens ]
• Official Symbol: IL10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451
• Gene ID: 3586
• mRNA Refseq: NM_000572
• Protein Refseq: NP_000563
• MIM: 124092
• UniProt ID: P22301
• Chromosome Location: 1q31-q32
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Asthma, organism-specific biosystem
• Function: cytokine activity; growth factor activity; interleukin-10 receptor binding