Recombinant Human IGLC1 protein, His-tagged

• Cat.No.: IGLC1-776H
• Product Overview: Recombinant Human IGLC1 protein(P0CG04)(1-106aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-106aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Gene Information

• Gene Name: CCND1 cyclin D1 [ Homo sapiens ]
• Official Symbol: IGLC1
• Synonyms: CCND1; cyclin D1; BCL1; PRAD1; U21B31; D11S287E; B-cell CLL/lymphoma 1; G1/S-specific cyclin D1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); parathyroid adenomatosis 1; BCL-1 oncogene; PRAD1 oncogene
• Gene ID: 595
• mRNA Refseq: NM_053056
• Protein Refseq: NP_444284
• MIM: 168461
• UniProt ID: P24385