Recombinant Human IGKV1-39 Protein, His-tagged

• Cat.No.: IGKV1-39-11H
• Product Overview: Recombinant Human IGKV1-39 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Predicted to be involved in immune response. Located in blood microparticle and extracellular exosome.
• Form: Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl, pH8.0.
• Molecular Mass: ~17.3 KDa
• AA Sequence: MEVFDYWGQGTLVTVSSGGGGSGGGGSGGGGSTDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSAANPDTFGQGTKVEIKRAAAHHHHHHGAAEQKLISEEDLNGAA
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.5 mg/ml

Gene Information

• Gene Name: IGKV1-39 immunoglobulin kappa variable 1-39 [ Homo sapiens (human) ]
• Official Symbol: IGKV1-39
• Synonyms: O12; O12a; IGKV139
• Gene ID: 28930
• UniProt ID: P01597