Recombinant Human IGF2R protein(501-580 aa), C-His-tagged

• Cat.No.: IGF2R-2639H
• Product Overview: Recombinant Human IGF2R protein(P11717)(501-580 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 501-580 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: AVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKT
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ]
• Official Symbol: IGF2R
• Synonyms: IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; M6PR; CI-MPR; MPR 300; M6P/IGF2R; IGF-II receptor; M6P/IGF2 receptor; CI Man-6-P receptor; 300 kDa mannose 6-phosphate receptor; insulin-like growth factor II receptor; cation-independent mannose-6 phosphate receptor; M6P-R
• Gene ID: 3482
• mRNA Refseq: NM_000876
• Protein Refseq: NP_000867
• MIM: 147280
• UniProt ID: P11717