Recombinant Human IGF1R protein, His-tagged

• Cat.No.: IGF1R-3080H
• Product Overview: Recombinant Human IGF1R protein(P08069)(763-931aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 763-931aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.4 kDa
• AA Sequence: YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ]
• Official Symbol: IGF1R
• Synonyms: IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172
• Gene ID: 3480
• mRNA Refseq: NM_000875
• Protein Refseq: NP_000866
• MIM: 147370
• UniProt ID: P08069