Recombinant human IFNA2, Active, His-tagged

• Cat.No.: IFNA2-1554H
• Product Overview: Recombinant human IFN-alpha-2a is a polypeptide single chain containing 171 amino acids with a predicted molecular mass of 20.1 kDa. Recombinant human IFN-alpha-2 contains a His-tag at the C-terminal end.

Specification

• Species: Human
• Source: Nicotiana Benthamiana
• Tag: His
• Protein Length: 171 a.a.
• Description: Interferon alpha 2a is an interferon class I produced by the cells of the innate immune system as a part of the defense response to foreign agents such as viruses, parasites and tumour cells. The human alpha-interferon family displays broad spectrum antiviral, antiproliferative and immunomodulatory activities on a variety of cell types. Interferon Alpha-2a (IFNa-2a), one of the subtypes, is a protein consisting of 165 amino acid. Its three-dimensional loop structure is maintained by two disulphide bridges. It has an approximate molecular weight of 20 kDa.
• Form: Recombinant human Interferon alpha 2a is lyophilized from a Tris HCl 0.05M buffer at pH 7.4 and 0.01% SDS.
• Molecular Mass: 20.1 kDa
• AA Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAA WDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKEHHHHHH
• Endotoxin: < 0.04="" eu/μg="" protein="" (lal="">
• Purity: >97% by SDS-PAGE gel
• Storage: This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
• Reconstitution: Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines.

Gene Information

• Gene Name: IFNA2 interferon, alpha 2 [ Homo sapiens ]
• Official Symbol: IFNA2
• Synonyms: IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765
• Gene ID: 3440
• mRNA Refseq: NM_000605
• Protein Refseq: NP_000596
• MIM: 147562
• UniProt ID: P01563
• Chromosome Location: 9p22
• Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem
• Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding