Recombinant Human ICOS Protein, His-tagged

Description :	ICOS (Inducible Co-Stimulator, CD278) is a member of the CD28 family that regulates T cell activity and immune responses. The ICOS protein contains an extracellular IgV-like domain, a transmembrane domain, and an intracellular domain with a YMFM motif. ICOS is primarily expressed on activated CD4+ and CD8+ T cells. Upon binding to its ligand, ICOS potentiates the T cell response to antigen through activation of the PI3K signaling pathway. In addition to enhancing T cell activation and proliferation, ICOS plays an important role in the regulation of T follicular helper cells. Research studies suggest that ICOS is a potential therapeutic target, and could serve as a prognostic biomarker for neoplastic therapy involving CTLA-4 blockade.
Source :	E. coli
Species :	Human
Tag :	His
Molecular Mass :	~15 kDa
AA Sequence :	MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Purity :	Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes :	For research use only, not for use in diagnostic procedure.
Storage :	Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer :	PBS, 4M Urea, pH7.4

Gene Name	ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ]
Official Symbol	ICOS
Synonyms	ICOS; inducible T-cell co-stimulator; inducible T-cell costimulator; activation inducible lymphocyte immunomediatory molecule; AILIM; CD278; inducible costimulator; activation-inducible lymphocyte immunomediatory molecule; CVID1; MGC39850;
Gene ID	29851
mRNA Refseq	NM_012092
Protein Refseq	NP_036224
MIM	604558
UniProt ID	Q9Y6W8