Recombinant Human ICOS Protein, His-tagged
Cat.No. : | ICOS-055H |
Product Overview : | Recombinant Human ICOS Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | ICOS (Inducible Co-Stimulator, CD278) is a member of the CD28 family that regulates T cell activity and immune responses. The ICOS protein contains an extracellular IgV-like domain, a transmembrane domain, and an intracellular domain with a YMFM motif. ICOS is primarily expressed on activated CD4+ and CD8+ T cells. Upon binding to its ligand, ICOS potentiates the T cell response to antigen through activation of the PI3K signaling pathway. In addition to enhancing T cell activation and proliferation, ICOS plays an important role in the regulation of T follicular helper cells. Research studies suggest that ICOS is a potential therapeutic target, and could serve as a prognostic biomarker for neoplastic therapy involving CTLA-4 blockade. |
Molecular Mass : | ~15 kDa |
AA Sequence : | MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | ICOS inducible T-cell co-stimulator [ Homo sapiens (human) ] |
Official Symbol | ICOS |
Synonyms | ICOS; inducible T-cell co-stimulator; inducible T-cell costimulator; activation inducible lymphocyte immunomediatory molecule; AILIM; CD278; inducible costimulator; activation-inducible lymphocyte immunomediatory molecule; CVID1; MGC39850; |
Gene ID | 29851 |
mRNA Refseq | NM_012092 |
Protein Refseq | NP_036224 |
MIM | 604558 |
UniProt ID | Q9Y6W8 |
◆ Recombinant Proteins | ||
Icos-6951MF | Recombinant Mouse Icos Protein, Fc-tagged, FITC conjugated | +Inquiry |
Icos-6951MAF488 | Recombinant Mouse Icos Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
ICOS-390H | Recombinant Human ICOS protein | +Inquiry |
ICOS-1248M | Acitve Recombinant Mouse ICOS protein(Met1-Gln135), His-tagged | +Inquiry |
ICOS-2636R | Recombinant Rat ICOS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICOS-1724MCL | Recombinant Mouse ICOS cell lysate | +Inquiry |
ICOS-2444HCL | Recombinant Human ICOS cell lysate | +Inquiry |
ICOS-1195RCL | Recombinant Rat ICOS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICOS Products
Required fields are marked with *
My Review for All ICOS Products
Required fields are marked with *
0
Inquiry Basket