Recombinant Human ICAM4 protein, His-tagged

• Cat.No.: ICAM4-3215H
• Product Overview: Recombinant Human ICAM4 protein(23-152 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 23-152 aa
• AA Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens ]
• Official Symbol: ICAM4
• Synonyms: ICAM4; intercellular adhesion molecule 4 (Landsteiner-Wiener blood group); intercellular adhesion molecule 4 (LW blood group) , intercellular adhesion molecule 4, Landsteiner Wiener blood group , Landsteiner Wiener blood group , LW; intercellular adhesion molecule 4; CD242; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group); LW
• Gene ID: 3386
• mRNA Refseq: NM_001039132
• Protein Refseq: NP_001034221
• MIM: 614088
• UniProt ID: Q14773